PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe6G143300.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family MYB
Protein Properties Length: 222aa    MW: 26147.9 Da    PI: 9.6534
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe6G143300.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding574.4e-181158148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                       rg+W++eEd+ll+++++++G g+W++++ + g++R++k+c++rw +yl
  Aqcoe6G143300.2.p 11 RGKWSEEEDDLLKKCIEKYGEGNWHKVPPRAGLKRCRKSCRLRWCNYL 58
                       89********************************************97 PP

2Myb_DNA-binding43.85.9e-1464108147
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                        r  ++ +E +l+++  k+lG++ W++Ia++++ gRt++++k+rw ++
  Aqcoe6G143300.2.p  64 RREFSWDEIDLIIKMQKLLGNR-WSLIAARLP-GRTANDIKNRWTTH 108
                        56899*****************.*********.***********886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.3E-21661IPR009057Homeodomain-like
PROSITE profilePS5129425.844662IPR017930Myb domain
SuperFamilySSF466896.11E-288105IPR009057Homeodomain-like
SMARTSM007173.1E-161060IPR001005SANT/Myb domain
PfamPF002493.8E-171158IPR001005SANT/Myb domain
CDDcd001671.13E-101358No hitNo description
Gene3DG3DSA:1.10.10.604.6E-2062102IPR009057Homeodomain-like
PROSITE profilePS5129417.90463113IPR017930Myb domain
SMARTSM007174.9E-1463111IPR001005SANT/Myb domain
PfamPF002491.7E-1264108IPR001005SANT/Myb domain
CDDcd001671.01E-866109No hitNo description
Gene3DG3DSA:1.10.10.601.6E-4103176IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 222 aa     Download sequence    Send to blast
MEQTNSSSLK RGKWSEEEDD LLKKCIEKYG EGNWHKVPPR AGLKRCRKSC RLRWCNYLNP  60
NTNRREFSWD EIDLIIKMQK LLGNRWSLIA ARLPGRTAND IKNRWTTHIS KSLRKNQEKQ  120
TETATPKIKA IKPKPLTFSQ NSPWMKSRLT EKAIQREKLH SNSLLGFQKE QTTSLWEGIT  180
FSEEDILGCT DEFEMESFFD ELTKPEKTEM CLDYLNIWKW S*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-1881134108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFJ9080900.0FJ908090.1 Aquilegia formosa R2R3-myb transcription factor (MYB12) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001275818.11e-58Myb transcription factor
SwissprotQ9FNV91e-51MY113_ARATH; Transcription factor MYB113
TrEMBLC4PAV21e-127C4PAV2_AQUFO; R2R3-myb transcription factor
STRINGVIT_14s0006g01290.t015e-56(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66370.11e-48myb domain protein 113